Home   >  
GPCR/G Protein
  >  
Melanocortin Receptor

Classified by application

All Products

Signaling Pathways

Research Areas

Nature products

Antibodies

Peptides

Catalysts

Impurities

Intermediate

Raw Materials

Melanocortin Receptor

Chemical Structure Cat. No. Product Name CAS No.
Nonapeptide-1 Chemical Structure
BCP25057 Nonapeptide-1 158563-45-2
Nonapeptide-1, a peptide hormone, is a potent α-Melanocyte-stimulating hormone (α-MSH) antagonist, with an IC50 of 11 nM. Reduces synthesis of melanin and helps decrease skin pigmentation to a substantial degree.
THIQ Chemical Structure
BCP31597 THIQ 312637-48-2
THIQ is a potent and selective melanocortin 4 receptor agonist (2,3) (IC50= 1.2, 761 and 2067 nM for human MC4, MC3 and MC1 receptors respectively).
Adrenocorticotropic Hormone, Human Chemical Structure
BCP30218 Adrenocorticotropic Hormone, Human 12279-41-3
Adrenocorticotropic Hormone , human is a melanocortin receptor agonist. Sequence: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe;SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF.
ACTH (1-39) (mouse, rat) Chemical Structure
BCP30334 ACTH (1-39) (mouse, rat) 77465-10-2
ACTH (1-39) (mouse, rat) is a potent melanocortin 2 (MC2) receptor agonist.
JNJ-10229570 Chemical Structure
BCP30848 JNJ-10229570 524923-88-4
JNJ-10229570 is a novel MC1R and MC5R antagonist was used to treat primary human sebaceous cells. It might have a potential for the treatment of acne and other sebaceous gland pathologies.
0086-13720134139