Home   >  
GPCR/G Protein
Melanocortin Receptor

Classified by application

All Products

Signaling Pathways

Research Areas

Nature products






Raw Materials

Melanocortin Receptor

Chemical Structure Cat. No. Product Name CAS No.
Adrenocorticotropic Hormone, Human Chemical Structure
BCP30218 Adrenocorticotropic Hormone, Human 12279-41-3
Adrenocorticotropic Hormone , human is a melanocortin receptor agonist. Sequence: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe;SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF.
ACTH (1-39) (mouse, rat) Chemical Structure
BCP30334 ACTH (1-39) (mouse, rat) 77465-10-2
ACTH (1-39) (mouse, rat) is a potent melanocortin 2 (MC2) receptor agonist.
JNJ-10229570 Chemical Structure
BCP30848 JNJ-10229570 524923-88-4
JNJ-10229570 is a novel MC1R and MC5R antagonist was used to treat primary human sebaceous cells. It might have a potential for the treatment of acne and other sebaceous gland pathologies.