Home

Classified by application

All Products

Signaling Pathways

Research Areas

Nature products

Antibodies

Peptides

Catalysts

Impurities

Intermediate

Raw Materials

Peptides

Chemical Structure Cat. No. Product Name CAS No.
HIV-1 Tat Protein (47-57) Chemical Structure
 BCP30436 HIV-1 Tat Protein (47-57) 191936-91-1
Prolylvaline Chemical Structure
 BCP30415 Prolylvaline 20488-27-1
Prolylvaline is a peptide with antibacterial properties.
ACTH (1-39) (mouse, rat) Chemical Structure
 BCP30334 ACTH (1-39) (mouse, rat) 77465-10-2
ACTH (1-39) (mouse, rat) is a potent melanocortin 2 (MC2) receptor agonist.
Somatostatin Chemical Structure
 BCP04492 Somatostatin 51110-01-1
Somatostatin is a tetradecapeptide which can suppress the growth hormone (GH) secretion and control the pituitary hormone secretion in human CNS.
Cathelicidin LL 37 (human) Chemical Structure
 BCP30243 Cathelicidin LL 37 (human) 154947-66-7
Sermorelin Chemical Structure
 BCP07348 Sermorelin 86168-78-7
Sermorelin is the biologically active fragment of human growth hormone-releasing factor, consisting of GHRH(1-29)-amide. This N-terminal sequence is identical in several mammalian species, such as human, pig, and cattle. It is used to diagnose or treat patients with GROWTH HORMONE deficiency.
Adrenocorticotropic Hormone, Human Chemical Structure
 BCP30218 Adrenocorticotropic Hormone, Human 12279-41-3
Adrenocorticotropic Hormone , human is a melanocortin receptor agonist. Sequence: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe;SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF.
MOG (35-55) Chemical Structure
 BCP30214 MOG (35-55) 149635-73-4
MOG 35-55 is a minor component of CNS myelin. Produces a relapsing-remitting neurological disease with extensive plaque-like demyelination.
Orexin A (human, rat, mouse) Chemical Structure
 BCP30215 Orexin A (human, rat, mouse) 205640-90-0
Orexin A (human, rat, mouse) is an Endogenous agonist at orexin receptors (Ki values are 20 and 38 nM for OX1 and OX2 receptors respectively). Stimulates feeding following central administration and may be involved in the control of sleep-wake cycle and other hypothalamic functions.
Amyloid β-peptide (25-35) (human) Chemical Structure
 BCP30213 Amyloid β-peptide (25-35) (human) 131602-53-4
Amyloid β-peptide (25-35) (human) is the fragment of human amyloid β-peptide, functionally required for the neurotrophic and neurotoxic effects associated with Alzheimer's disease.
123下一页末页共 110 条记录 1 / 11 页 
0086-15971444841