Home

Classified by application

All Products

Signaling Pathways

Research Areas

Nature products

Antibodies

Peptides

Catalysts

Impurities

Intermediate

Raw Materials

Peptides

Chemical Structure Cat. No. Product Name CAS No.
Sermorelin Chemical Structure
 BCP07348 Sermorelin 86168-78-7
Sermorelin is the biologically active fragment of human growth hormone-releasing factor, consisting of GHRH(1-29)-amide. This N-terminal sequence is identical in several mammalian species, such as human, pig, and cattle. It is used to diagnose or treat patients with GROWTH HORMONE deficiency.
Adrenocorticotropic Hormone, Human Chemical Structure
 BCP30218 Adrenocorticotropic Hormone, Human 12279-41-3
Adrenocorticotropic Hormone , human is a melanocortin receptor agonist. Sequence: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe;SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF.
MOG (35-55) Chemical Structure
 BCP30214 MOG (35-55) 149635-73-4
MOG 35-55 is a minor component of CNS myelin. Produces a relapsing-remitting neurological disease with extensive plaque-like demyelination.
Orexin A (human, rat, mouse) Chemical Structure
 BCP30215 Orexin A (human, rat, mouse) 205640-90-0
Orexin A (human, rat, mouse) is an Endogenous agonist at orexin receptors (Ki values are 20 and 38 nM for OX1 and OX2 receptors respectively). Stimulates feeding following central administration and may be involved in the control of sleep-wake cycle and other hypothalamic functions.
Amyloid β-peptide (25-35) (human) Chemical Structure
 BCP30213 Amyloid β-peptide (25-35) (human) 131602-53-4
Amyloid β-peptide (25-35) (human) is the fragment of human amyloid β-peptide, functionally required for the neurotrophic and neurotoxic effects associated with Alzheimer's disease.
Amyloid β-Peptide (1-40) (human) Chemical Structure
 BCP30212 Amyloid β-Peptide (1-40) (human) 131438-79-4
Amyloid β-Peptide (1-40) (human) is found in plaques in the brains of patients with Alzheimer's disease. Shown to have both neurotrophic and neurotoxic effects.
Abaloparatide Chemical Structure
 BCP25362 Abaloparatide 247062-33-5
Abaloparatide is an analog of PTHrP (parathyroid hormone-related protein).
Enfuvirtide Chemical Structure
 BCP24780 Enfuvirtide 159519-65-0
Enfuvirtide is an anti-HIV-1 fusion inhibitor peptide.
Splenopentin Acetate Chemical Structure
 BCP27651 Splenopentin Acetate 105184-37-0
Splenopentin, also known as SP-5, is a synthetic immunomodulating peptide corresponding to the region 32-34 of a splenic product called splenin (SP) and the thymic hormone thymopoietin (TP), respectively.
Teriparatide Acetate Chemical Structure
 BCP27658 Teriparatide Acetate 99294-94-7
Teriparatide is a polypeptide that consists of the 1-34 amino-acid fragment of human PARATHYROID HORMONE, the biologically active N-terminal region. The acetate form is given by intravenous infusion in the differential diagnosis of HYPOPARATHYROIDISM and PSEUDOHYPOPARATHYROIDISM.
123下一页末页共 105 条记录 1 / 11 页 
0086-13720134139